Lineage for d6aujc_ (6auj C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972588Species Elizabethkingia anophelis [TaxId:1338011] [339475] (1 PDB entry)
  8. 2972591Domain d6aujc_: 6auj C: [339502]
    Other proteins in same PDB: d6auja2, d6aujb2
    automated match to d4knza_
    complexed with pge

Details for d6aujc_

PDB Entry: 6auj (more details), 1.7 Å

PDB Description: crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d6aujc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aujc_ d.117.1.1 (C:) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
mqnylhllqdildngsdktdrtgtgtrslfgyqlrydlskgfplvttkkvhlksiiyell
wflkgdtnikylkdngvsiwdewadengdlgpvygaqwrswrgadnkvvdqisevidqik
knpdsrrlivsawnvaeipnmalapchamfqfyvadgklslqlyqrsadvflgvpfnias
yalllmmvaqvtglqvgdyvhsfgdvhiynnhfeqvnrqlsrdpkplpvmklnpdvkdif
dfkfedfelln

SCOPe Domain Coordinates for d6aujc_:

Click to download the PDB-style file with coordinates for d6aujc_.
(The format of our PDB-style files is described here.)

Timeline for d6aujc_: