Lineage for d5jcbb1 (5jcb B:2-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472102Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)
  8. 2472147Domain d5jcbb1: 5jcb B:2-245 [339500]
    Other proteins in same PDB: d5jcba2, d5jcbb2, d5jcbc2, d5jcbd2, d5jcbe_, d5jcbf1, d5jcbf2
    automated match to d4drxb1
    complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg

Details for d5jcbb1

PDB Entry: 5jcb (more details), 2.3 Å

PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5jcbb1:

Sequence, based on SEQRES records: (download)

>d5jcbb1 c.32.1.1 (B:2-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Sequence, based on observed residues (ATOM records): (download)

>d5jcbb1 c.32.1.1 (B:2-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyynegnkyvpra
ilvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrke
sescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvvepy
natlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclrfp

SCOPe Domain Coordinates for d5jcbb1:

Click to download the PDB-style file with coordinates for d5jcbb1.
(The format of our PDB-style files is described here.)

Timeline for d5jcbb1: