Lineage for d5jcba2 (5jcb A:246-439)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) 
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) 
Domain d5jcba2: 5jcb A:246-439 [339499]
Other proteins in same PDB: d5jcba1, d5jcbb1, d5jcbc1, d5jcbd1, d5jcbe_, d5jcbf1, d5jcbf2
automated match to d4i50a2
complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg
Details for d5jcba2
PDB Entry: 5jcb (more details), 2.3 Å
PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1
PDB Compounds: (A:) Tubulin alpha-1B chainSCOPe Domain Sequences for d5jcba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jcba2 d.79.2.1 (A:246-439) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds
SCOPe Domain Coordinates for d5jcba2:
Click to download the PDB-style file with coordinates for d5jcba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jcba2:
View in 3D
