| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
| Protein automated matches [191113] (13 species) not a true protein |
| Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries) |
| Domain d5gy0a2: 5gy0 A:472-628 [339495] Other proteins in same PDB: d5gy0a1, d5gy0b1 automated match to d1tf4a2 complexed with br, ca, cl, pg4 |
PDB Entry: 5gy0 (more details), 1.74 Å
SCOPe Domain Sequences for d5gy0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gy0a2 b.2.2.0 (A:472-628) automated matches {Clostridium thermocellum [TaxId: 1515]}
effveaainqasdhfteikallnnrsswparlikdlsynyymdltevfeagysvddikvt
igycesgmdveispithlydniyyikisyidgtnicpigqeqyaaelqfriaapqgtkfw
dptndfsyqgltrelaktkympvfdgatkifgevpgg
Timeline for d5gy0a2: