![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
![]() | Protein automated matches [190108] (21 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries) |
![]() | Domain d5gy1b1: 5gy1 B:30-471 [339480] Other proteins in same PDB: d5gy1a2, d5gy1b2 automated match to d1tf4a1 complexed with bgc, br, ca, cl |
PDB Entry: 5gy1 (more details), 1.99 Å
SCOPe Domain Sequences for d5gy1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gy1b1 a.102.1.0 (B:30-471) automated matches {Clostridium thermocellum [TaxId: 1515]} synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagahvkfnlpmay saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc rltaeyggtplanfpppeqrdd
Timeline for d5gy1b1: