Lineage for d1efkb2 (1efk B:21-279)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890498Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 2890505Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 2890523Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)
  8. 2890547Domain d1efkb2: 1efk B:21-279 [33948]
    Other proteins in same PDB: d1efka1, d1efkb1, d1efkc1, d1efkd1
    complexed with mak, mg, nad

Details for d1efkb2

PDB Entry: 1efk (more details), 2.6 Å

PDB Description: structure of human malic enzyme in complex with ketomalonate
PDB Compounds: (B:) malic enzyme

SCOPe Domain Sequences for d1efkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efkb2 c.58.1.3 (B:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

SCOPe Domain Coordinates for d1efkb2:

Click to download the PDB-style file with coordinates for d1efkb2.
(The format of our PDB-style files is described here.)

Timeline for d1efkb2: