Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries) |
Domain d5hanf1: 5han F:1-138 [339478] Other proteins in same PDB: d5hana2, d5hanb2, d5hanc2, d5hand2, d5hane2, d5hanf2, d5hang2, d5hanh2, d5hani2, d5hanj2, d5hank2, d5hanl2 automated match to d4lf2a1 complexed with cap, mg; mutant |
PDB Entry: 5han (more details), 2.04 Å
SCOPe Domain Sequences for d5hanf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hanf1 d.58.9.0 (F:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevft tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5hanf1: