SCOPe 2.08: Domain d5hath2: 5hat H:139-456

Lineage for d5hath2 (5hat H:139-456)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (16 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries)

8. Domain d5hath2: 5hat H:139-456 [339474]
   Other proteins in same PDB: d5hata1, d5hatb1, d5hatc1, d5hatd1, d5hate1, d5hatf1, d5hatg1, d5hath1, d5hati1, d5hatj1, d5hatk1, d5hatl1
   automated match to d4lf2a2
   complexed with cap, mg; mutant

Details for d5hath2

PDB Entry: 5hat, 2 Å

PDB Description: structure function studies of r. palustris rubisco (s59f/m331a mutant; cabp-bound)

PDB Compounds: (H:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hath2:

Sequence; same for both SEQRES and ATOM records:

>d5hath2 c.1.14.1 (H:139-456) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrakl

Timeline for d5hath2:

• d5hath2 first appeared in SCOPe 2.06
  
• d5hath2 appears in SCOPe 2.07