Lineage for d1efka2 (1efk A:21-279)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) 
Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strandProtein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species) Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries) 
Domain d1efka2: 1efk A:21-279 [33947]
Other proteins in same PDB: d1efka1, d1efkb1, d1efkc1, d1efkd1
complexed with mak, mg, nad
Details for d1efka2
PDB Entry: 1efk (more details), 2.6 Å
PDB Description: structure of human malic enzyme in complex with ketomalonate
PDB Compounds: (A:) malic enzymeSCOPe Domain Sequences for d1efka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efka2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd
SCOPe Domain Coordinates for d1efka2:
Click to download the PDB-style file with coordinates for d1efka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efka2:
View in 3D
