Lineage for d5hanh2 (5han H:139-456)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100573Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2100772Protein automated matches [226984] (9 species)
    not a true protein
  7. 2100862Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries)
  8. 2100888Domain d5hanh2: 5han H:139-456 [339468]
    Other proteins in same PDB: d5hana1, d5hanb1, d5hand1, d5hanf1, d5hanh1, d5hani1, d5hank1, d5hanl1
    automated match to d4lf2a2
    complexed with cap, mg; mutant

Details for d5hanh2

PDB Entry: 5han (more details), 2.04 Å

PDB Description: structure function studies of r. palustris rubisco (s59f mutant; cabp- bound)
PDB Compounds: (H:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hanh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hanh2 c.1.14.1 (H:139-456) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrakl

SCOPe Domain Coordinates for d5hanh2:

Click to download the PDB-style file with coordinates for d5hanh2.
(The format of our PDB-style files is described here.)

Timeline for d5hanh2: