Lineage for d5hatb1 (5hat B:1-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559863Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2559864Protein automated matches [226983] (27 species)
    not a true protein
  7. 2560037Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)
  8. 2560045Domain d5hatb1: 5hat B:1-138 [339463]
    Other proteins in same PDB: d5hata2, d5hatb2, d5hatc2, d5hatd2, d5hate2, d5hatf2, d5hatg2, d5hath2, d5hati2, d5hatj2, d5hatk2, d5hatl2
    automated match to d4lf2a1
    complexed with cap, mg; mutant

Details for d5hatb1

PDB Entry: 5hat (more details), 2 Å

PDB Description: structure function studies of r. palustris rubisco (s59f/m331a mutant; cabp-bound)
PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hatb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hatb1 d.58.9.0 (B:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevft
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hatb1:

Click to download the PDB-style file with coordinates for d5hatb1.
(The format of our PDB-style files is described here.)

Timeline for d5hatb1: