Lineage for d5gyna_ (5gyn A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (53 species)
    not a true protein
  7. 2491741Species Human (Homo sapiens) [TaxId:9606] [188990] (18 PDB entries)
  8. 2491750Domain d5gyna_: 5gyn A: [339459]
    automated match to d2cfta_
    complexed with mg; mutant

Details for d5gyna_

PDB Entry: 5gyn (more details), 2 Å

PDB Description: crystal structure of human pyridoxal 5'-phosphate phosphatase (chronophin) mutant - c221s
PDB Compounds: (A:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d5gyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gyna_ c.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
marcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnn
srrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglra
elraaglrlagdpsagdgaaprvravlvgydehfsfaklreacahlrdpecllvatdrdp
whplsdgsrtpgtgslaaavetasgrqalvvgkpspymfesitenfsidpartlmvgdrl
etdilfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegle

SCOPe Domain Coordinates for d5gyna_:

Click to download the PDB-style file with coordinates for d5gyna_.
(The format of our PDB-style files is described here.)

Timeline for d5gyna_: