![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (12 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries) |
![]() | Domain d5gxxa2: 5gxx A:472-628 [339457] Other proteins in same PDB: d5gxxa1, d5gxxa3, d5gxxb1 automated match to d1tf4a2 complexed with ca, cl, trs |
PDB Entry: 5gxx (more details), 1.5 Å
SCOPe Domain Sequences for d5gxxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gxxa2 b.2.2.0 (A:472-628) automated matches {Clostridium thermocellum [TaxId: 1515]} effveaainqasdhfteikallnnrsswparlikdlsynyymdltevfeagysvddikvt igycesgmdveispithlydniyyikisyidgtnicpigqeqyaaelqfriaapqgtkfw dptndfsyqgltrelaktkympvfdgatkifgevpgg
Timeline for d5gxxa2: