Lineage for d5gxxa2 (5gxx A:472-628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767391Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)
  8. 2767399Domain d5gxxa2: 5gxx A:472-628 [339457]
    Other proteins in same PDB: d5gxxa1, d5gxxa3, d5gxxb1
    automated match to d1tf4a2
    complexed with ca, cl, trs

Details for d5gxxa2

PDB Entry: 5gxx (more details), 1.5 Å

PDB Description: crystal structure of endoglucanase celq from clostridium thermocellum complexed with tris
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5gxxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxxa2 b.2.2.0 (A:472-628) automated matches {Clostridium thermocellum [TaxId: 1515]}
effveaainqasdhfteikallnnrsswparlikdlsynyymdltevfeagysvddikvt
igycesgmdveispithlydniyyikisyidgtnicpigqeqyaaelqfriaapqgtkfw
dptndfsyqgltrelaktkympvfdgatkifgevpgg

SCOPe Domain Coordinates for d5gxxa2:

Click to download the PDB-style file with coordinates for d5gxxa2.
(The format of our PDB-style files is described here.)

Timeline for d5gxxa2: