SCOPe 2.08: Domain d5gxzb2: 5gxz B:472-628

Lineage for d5gxzb2 (5gxz B:472-628)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (13 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)

8. Domain d5gxzb2: 5gxz B:472-628 [339450]
   Other proteins in same PDB: d5gxza1, d5gxzb1
   automated match to d1tf4a2
   complexed with 7pe, br, ca, cl

Details for d5gxzb2

PDB Entry: 5gxz, 2.05 Å

PDB Description: crystal structure of endoglucanase celq from clostridium thermocellum complexed with cellobiose and cellotriose

PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5gxzb2:

Sequence; same for both SEQRES and ATOM records:

>d5gxzb2 b.2.2.0 (B:472-628) automated matches {Clostridium thermocellum [TaxId: 1515]}
effveaainqasdhfteikallnnrsswparlikdlsynyymdltevfeagysvddikvt
igycesgmdveispithlydniyyikisyidgtnicpigqeqyaaelqfriaapqgtkfw
dptndfsyqgltrelaktkympvfdgatkifgevpgg

Timeline for d5gxzb2:

• d5gxzb2 first appeared in SCOPe 2.06
  
• d5gxzb2 appears in SCOPe 2.07