SCOPe 2.08: Domain d1eflc2: 1efl C:21-279

Lineage for d1eflc2 (1efl C:21-279)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1eflc2: 1efl C:21-279 [33945]
   Other proteins in same PDB: d1efla1, d1eflb1, d1eflc1, d1efld1
   complexed with mg, nad, ttn

Details for d1eflc2

PDB Entry: 1efl, 2.6 Å

PDB Description: human malic enzyme in a quaternary complex with nad, mg, and tartronate

PDB Compounds: (C:) malic enzyme

SCOPe Domain Sequences for d1eflc2:

Sequence; same for both SEQRES and ATOM records:

>d1eflc2 c.58.1.3 (C:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

Timeline for d1eflc2:

• d1eflc2 first appeared (with stable ids) in SCOP 1.55
  
• d1eflc2 appears in SCOPe 2.07