Lineage for d5gxzb1 (5gxz B:30-471)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007006Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2007233Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2007234Protein automated matches [190108] (16 species)
    not a true protein
  7. 2007250Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries)
  8. 2007261Domain d5gxzb1: 5gxz B:30-471 [339449]
    Other proteins in same PDB: d5gxza2, d5gxzb2
    automated match to d1tf4a1
    complexed with 7pe, bgc, br, ca, cl

Details for d5gxzb1

PDB Entry: 5gxz (more details), 2.05 Å

PDB Description: crystal structure of endoglucanase celq from clostridium thermocellum complexed with cellobiose and cellotriose
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5gxzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxzb1 a.102.1.0 (B:30-471) automated matches {Clostridium thermocellum [TaxId: 1515]}
synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay
saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc
rltaeyggtplanfpppeqrdd

SCOPe Domain Coordinates for d5gxzb1:

Click to download the PDB-style file with coordinates for d5gxzb1.
(The format of our PDB-style files is described here.)

Timeline for d5gxzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gxzb2