SCOPe 2.08: Domain d5gxzb1: 5gxz B:30-471

Lineage for d5gxzb1 (5gxz B:30-471)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (23 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries)

8. Domain d5gxzb1: 5gxz B:30-471 [339449]
   Other proteins in same PDB: d5gxza2, d5gxzb2
   automated match to d1tf4a1
   complexed with 7pe, br, ca, cl

Details for d5gxzb1

PDB Entry: 5gxz, 2.05 Å

PDB Description: crystal structure of endoglucanase celq from clostridium thermocellum complexed with cellobiose and cellotriose

PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5gxzb1:

Sequence; same for both SEQRES and ATOM records:

>d5gxzb1 a.102.1.0 (B:30-471) automated matches {Clostridium thermocellum [TaxId: 1515]}
synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay
saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc
rltaeyggtplanfpppeqrdd

Timeline for d5gxzb1:

• d5gxzb1 first appeared in SCOPe 2.06
  
• d5gxzb1 appears in SCOPe 2.07