Class a: All alpha proteins [46456] (290 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
Protein automated matches [190108] (23 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries) |
Domain d5gy0b1: 5gy0 B:30-471 [339445] Other proteins in same PDB: d5gy0a2, d5gy0b2 automated match to d1tf4a1 complexed with br, ca, cl, pg4 |
PDB Entry: 5gy0 (more details), 1.74 Å
SCOPe Domain Sequences for d5gy0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gy0b1 a.102.1.0 (B:30-471) automated matches {Clostridium thermocellum [TaxId: 1515]} synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknavacdynagfvgalc rltaeyggtplanfpppeqrdd
Timeline for d5gy0b1: