![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (12 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries) |
![]() | Domain d5gxyb2: 5gxy B:472-628 [339444] Other proteins in same PDB: d5gxya1, d5gxyb1 automated match to d1tf4a2 complexed with 7pe, bgc, br, ca, cl, trs |
PDB Entry: 5gxy (more details), 1.7 Å
SCOPe Domain Sequences for d5gxyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gxyb2 b.2.2.0 (B:472-628) automated matches {Clostridium thermocellum [TaxId: 1515]} effveaainqasdhfteikallnnrsswparlikdlsynyymdltevfeagysvddikvt igycesgmdveispithlydniyyikisyidgtnicpigqeqyaaelqfriaapqgtkfw dptndfsyqgltrelaktkympvfdgatkifgevpgg
Timeline for d5gxyb2: