Lineage for d5gxyb2 (5gxy B:472-628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767391Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)
  8. 2767398Domain d5gxyb2: 5gxy B:472-628 [339444]
    Other proteins in same PDB: d5gxya1, d5gxyb1
    automated match to d1tf4a2
    complexed with 7pe, br, ca, cl, trs

Details for d5gxyb2

PDB Entry: 5gxy (more details), 1.7 Å

PDB Description: crystal structure of endoglucanase celq from clostridium thermocellum complexed with cellobiose and tris
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d5gxyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxyb2 b.2.2.0 (B:472-628) automated matches {Clostridium thermocellum [TaxId: 1515]}
effveaainqasdhfteikallnnrsswparlikdlsynyymdltevfeagysvddikvt
igycesgmdveispithlydniyyikisyidgtnicpigqeqyaaelqfriaapqgtkfw
dptndfsyqgltrelaktkympvfdgatkifgevpgg

SCOPe Domain Coordinates for d5gxyb2:

Click to download the PDB-style file with coordinates for d5gxyb2.
(The format of our PDB-style files is described here.)

Timeline for d5gxyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gxyb1