SCOPe 2.07: Domain d5gy1a1: 5gy1 A:30-471

Lineage for d5gy1a1 (5gy1 A:30-471)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (21 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [255683] (6 PDB entries)

8. Domain d5gy1a1: 5gy1 A:30-471 [339441]
   Other proteins in same PDB: d5gy1a2, d5gy1b2
   automated match to d1tf4a1
   complexed with bgc, br, ca, cl

Details for d5gy1a1

PDB Entry: 5gy1, 1.99 Å

PDB Description: crystal structure of endoglucanase celq from clostridium thermocellum complexed with cellotriose

PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5gy1a1:

Sequence; same for both SEQRES and ATOM records:

>d5gy1a1 a.102.1.0 (A:30-471) automated matches {Clostridium thermocellum [TaxId: 1515]}
synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagahvkfnlpmay
saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc
rltaeyggtplanfpppeqrdd

Timeline for d5gy1a1:

• d5gy1a1 first appeared in SCOPe 2.06
  
• d5gy1a1 appears in the current release, SCOPe 2.08