Lineage for d1eflb2 (1efl B:21-279)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489479Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 489480Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 489613Family c.58.1.3: Malic enzyme N-domain (Pfam 00390) [53240] (2 proteins)
    this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 489620Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 489638Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)
  8. 489666Domain d1eflb2: 1efl B:21-279 [33944]
    Other proteins in same PDB: d1efla1, d1eflb1, d1eflc1, d1efld1

Details for d1eflb2

PDB Entry: 1efl (more details), 2.6 Å

PDB Description: human malic enzyme in a quaternary complex with nad, mg, and tartronate

SCOP Domain Sequences for d1eflb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eflb2 c.58.1.3 (B:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

SCOP Domain Coordinates for d1eflb2:

Click to download the PDB-style file with coordinates for d1eflb2.
(The format of our PDB-style files is described here.)

Timeline for d1eflb2: