![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries) |
![]() | Domain d5f47a_: 5f47 A: [339438] automated match to d5hmnc_ complexed with ca, cl |
PDB Entry: 5f47 (more details), 1.5 Å
SCOPe Domain Sequences for d5f47a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f47a_ d.108.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]} idnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallen kivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvq adkvddyaldfyrstkptaeeqvvhfyytlk
Timeline for d5f47a_: