Lineage for d6b1pa2 (6b1p A:300-462)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329348Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2329349Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2329376Family a.97.1.0: automated matches [227179] (1 protein)
    not a true family
  6. 2329377Protein automated matches [226898] (6 species)
    not a true protein
  7. 2329383Species Helicobacter pylori [TaxId:563041] [339433] (1 PDB entry)
  8. 2329384Domain d6b1pa2: 6b1p A:300-462 [339434]
    Other proteins in same PDB: d6b1pa1
    automated match to d4g6za2
    complexed with edo

Details for d6b1pa2

PDB Entry: 6b1p (more details), 2.5 Å

PDB Description: crystal structure of glutamate-trna synthetase from helicobacter pylori
PDB Compounds: (A:) Glutamate--tRNA ligase 1

SCOPe Domain Sequences for d6b1pa2:

Sequence, based on SEQRES records: (download)

>d6b1pa2 a.97.1.0 (A:300-462) automated matches {Helicobacter pylori [TaxId: 563041]}
swhklnwlnahylknqsaqkllellkpfsfsdlshlnpaqldrlldalkersqtlkelal
kidevliapveyeekvfkklnqalimpllekfklelkeanfndesalenamhkiieeeki
kagsfmqplrlallgkgggiglkealfilgktesvkrienflk

Sequence, based on observed residues (ATOM records): (download)

>d6b1pa2 a.97.1.0 (A:300-462) automated matches {Helicobacter pylori [TaxId: 563041]}
swhklnwlnahylknqsaqkllellkpfsfsdlshlnpadrlldalkersqtlkelalki
devliapveyeekvfkklnqalimpllekfklelkeanfmhkiieeekikagsfmqplrl
allgkgggiglkealfilgktesvkrienflk

SCOPe Domain Coordinates for d6b1pa2:

Click to download the PDB-style file with coordinates for d6b1pa2.
(The format of our PDB-style files is described here.)

Timeline for d6b1pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b1pa1