SCOPe 2.08: Domain d6b1pa2: 6b1p A:300-462

Lineage for d6b1pa2 (6b1p A:300-462)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.0: automated matches [227179] (1 protein)
   not a true family

6. Protein automated matches [226898] (7 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:563041] [339433] (1 PDB entry)

8. Domain d6b1pa2: 6b1p A:300-462 [339434]
   Other proteins in same PDB: d6b1pa1
   automated match to d4g6za2
   complexed with edo

Details for d6b1pa2

PDB Entry: 6b1p, 2.5 Å

PDB Description: crystal structure of glutamate-trna synthetase from helicobacter pylori

PDB Compounds: (A:) Glutamate--tRNA ligase 1

SCOPe Domain Sequences for d6b1pa2:

Sequence, based on SEQRES records:

>d6b1pa2 a.97.1.0 (A:300-462) automated matches {Helicobacter pylori [TaxId: 563041]}
swhklnwlnahylknqsaqkllellkpfsfsdlshlnpaqldrlldalkersqtlkelal
kidevliapveyeekvfkklnqalimpllekfklelkeanfndesalenamhkiieeeki
kagsfmqplrlallgkgggiglkealfilgktesvkrienflk

Sequence, based on observed residues (ATOM records):

>d6b1pa2 a.97.1.0 (A:300-462) automated matches {Helicobacter pylori [TaxId: 563041]}
swhklnwlnahylknqsaqkllellkpfsfsdlshlnpadrlldalkersqtlkelalki
devliapveyeekvfkklnqalimpllekfklelkeanfmhkiieeekikagsfmqplrl
allgkgggiglkealfilgktesvkrienflk

Timeline for d6b1pa2:

• d6b1pa2 first appeared in SCOPe 2.06
  
• d6b1pa2 appears in SCOPe 2.07