Lineage for d6b1pa1 (6b1p A:2-299)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (53 species)
    not a true protein
  7. 2443270Species Helicobacter pylori [TaxId:563041] [339431] (2 PDB entries)
  8. 2443271Domain d6b1pa1: 6b1p A:2-299 [339432]
    Other proteins in same PDB: d6b1pa2
    automated match to d4g6za1
    complexed with edo

Details for d6b1pa1

PDB Entry: 6b1p (more details), 2.5 Å

PDB Description: crystal structure of glutamate-trna synthetase from helicobacter pylori
PDB Compounds: (A:) Glutamate--tRNA ligase 1

SCOPe Domain Sequences for d6b1pa1:

Sequence, based on SEQRES records: (download)

>d6b1pa1 c.26.1.0 (A:2-299) automated matches {Helicobacter pylori [TaxId: 563041]}
slivtrfapsptgylhigglrtaifnylfaranqgkfflriedtdlsrnsieaanaiiea
fkwvgleydgeilyqskrfeiykeyiqklldedkayycymskdeldalreeqkarketpr
ydnryrdfkgtppkgiepvvrikvpqnevigfndgvkgevkvntnelddfiiarsdgtpt
ynfvvivddalmgitdvirgddhlsntpkqivlykalnfkipnffhvpmilneegqklsk
rhgatnvmdyqemgylkealvnflvrlgwsyqdkeifsmqellecfdpkdlnsspscf

Sequence, based on observed residues (ATOM records): (download)

>d6b1pa1 c.26.1.0 (A:2-299) automated matches {Helicobacter pylori [TaxId: 563041]}
slivtrfapsptgylhigglrtaifnylfaranqgkfflriedtdlsrnsieaanaiiea
fkwvgleydgeilyqskrfeiykeyiqklldedkayycymskdeldalreeppkgiepvv
rikvpqnevigfndgvkgevkvntnelddfiiarsdgtptynfvvivddalmgitdvirg
ddhlsntpkqivlykalnfkipnffhvpmilneegqklskrhgatnvmdyqemgylkeal
vnflvrlgwsyqdkeifsmqellecfdpkdlnsspscf

SCOPe Domain Coordinates for d6b1pa1:

Click to download the PDB-style file with coordinates for d6b1pa1.
(The format of our PDB-style files is described here.)

Timeline for d6b1pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b1pa2