Lineage for d6axea1 (6axe A:1-730)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424043Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2424044Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2424086Protein automated matches [195320] (5 species)
    not a true protein
  7. 2424090Species Mycobacterium marinum [TaxId:216594] [339424] (1 PDB entry)
  8. 2424091Domain d6axea1: 6axe A:1-730 [339427]
    Other proteins in same PDB: d6axea2
    automated match to d3s9za_
    complexed with aco, act, edo, mg

Details for d6axea1

PDB Entry: 6axe (more details), 1.6 Å

PDB Description: crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d6axea1:

Sequence, based on SEQRES records: (download)

>d6axea1 c.1.13.1 (A:1-730) automated matches {Mycobacterium marinum [TaxId: 216594]}
mtdrvsagnlrvarvlydfvnnealpgtdidqdsfwagvdkvvtdltpqnqdllktrddl
qaqidkwhrhrviepldpqayreflteigyllpapedftittsgvddeitttagpqlvvp
ilnarfalnaanarwgslydalygtdvisesdgaekgrgynkvrgdkviayarqflddsv
plagasytdatgfkvedgqlvvsladtsaaladpgqfagytgtaenpksillanhglhie
ilidpesqigatdgagvkdvilesaittimdfedsvaavdaddkvlgyrnwlglnrgdls
edvtkddktftrvlntdrtytaphggeltlpgrsllfvrnvghlmtndaivsdaegaega
pvfegimdalftgliaihglrstdanglltnsrtgsiyivkpkmhgpaevaftcelfsrv
edvlglpqgtmkvgimdeerrttlnlkacikaaadrvvfintgfldrtgdeihtsmeagp
mirkgamkntawikayedanvdtglaagfsgkaqigkgmwamtelmadmveqkiaqpkag
attawvpsptaatlhamhyhkvdvfavqkelqgktrtsvdelltiplakelawapeeire
evdnncqsilgyvvrwidqgvgcskvpdihnvalmedratlrissqllanwlrhgvitse
daraslermaplvdkqnagdpeyhamapnfddsiaflaaqdlilsgaqqpngytepilhr
rrrelkarag

Sequence, based on observed residues (ATOM records): (download)

>d6axea1 c.1.13.1 (A:1-730) automated matches {Mycobacterium marinum [TaxId: 216594]}
mtdrvsagnlrvarvlydfvnnealpgtdidqdsfwagvdkvvtdltpqnqdllktrddl
qaqidkwhrhrviepldpqayreflteigyllpapedftittsgvddeitttagpqlvvp
ilnarfalnaanarwgslydalygtdvisesdgaekgrgynkvrgdkviayarqflddsv
plagasytdatgfkvedgqlvvsladtsaaladpgqfagytgtaenpksillanhglhie
ilidpesqigatdgagvkdvilesaittimdfedsvaavdaddkvlgyrnwlglnrgdls
edvtkktftrvlntdrtytaphggeltlpgrsllfvrnvghlmtndaivsdaegaegapv
fegimdalftgliaihglrstdanglltnsrtgsiyivkpkmhgpaevaftcelfsrved
vlglpqgtmkvgimdeerrttlnlkacikaaadrvvfintgfldrtgdeihtsmeagpmi
rkgamkntawikayedanvdtglaagfsgkaqigkgmwamtelmadmveqkiaqpkagat
tawvpsptaatlhamhyhkvdvfavqkelqgktrtsvdelltiplakelawapeeireev
dnncqsilgyvvrwidqgvgcskvpdihnvalmedratlrissqllanwlrhgvitseda
raslermaplvdkqnagdpeyhamapnfddsiaflaaqdlilsgaqqpngytepilhrrr
relkarag

SCOPe Domain Coordinates for d6axea1:

Click to download the PDB-style file with coordinates for d6axea1.
(The format of our PDB-style files is described here.)

Timeline for d6axea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6axea2
View in 3D
Domains from other chains:
(mouse over for more information)
d6axeb_