| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
| Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
| Protein automated matches [191000] (4 species) not a true protein |
| Species Pisum sativum [TaxId:3888] [339410] (1 PDB entry) |
| Domain d5xnlf_: 5xnl F: [339423] Other proteins in same PDB: d5xnla_, d5xnlc_, d5xnld_, d5xnlk_, d5xnlo_ automated match to d4ub8f_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnlf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnlf_ f.23.38.1 (F:) automated matches {Pisum sativum [TaxId: 3888]}
ftvrwlavhglavptvfflgsisamqfiqr
Timeline for d5xnlf_: