Lineage for d5xnlf_ (5xnl F:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254945Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2254946Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2254970Protein automated matches [191000] (4 species)
    not a true protein
  7. 2254971Species Pisum sativum [TaxId:3888] [339410] (1 PDB entry)
  8. 2254973Domain d5xnlf_: 5xnl F: [339423]
    Other proteins in same PDB: d5xnla_, d5xnlc_, d5xnld_, d5xnlk_, d5xnlo_
    automated match to d4ub8f_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlf_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (F:) Cytochrome b559 subunit beta, PsbF

SCOPe Domain Sequences for d5xnlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnlf_ f.23.38.1 (F:) automated matches {Pisum sativum [TaxId: 3888]}
ftvrwlavhglavptvfflgsisamqfiqr

SCOPe Domain Coordinates for d5xnlf_:

Click to download the PDB-style file with coordinates for d5xnlf_.
(The format of our PDB-style files is described here.)

Timeline for d5xnlf_: