SCOPe 2.08: Domain d5xnlf_: 5xnl F:

Lineage for d5xnlf_ (5xnl F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [339410] (1 PDB entry)

8. Domain d5xnlf_: 5xnl F: [339423]
   Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
   automated match to d4ub8f_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlf_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (F:) Cytochrome b559 subunit beta, PsbF

SCOPe Domain Sequences for d5xnlf_:

Sequence; same for both SEQRES and ATOM records:

>d5xnlf_ f.23.38.1 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
ftvrwlavhglavptvfflgsisamqfiqr

Timeline for d5xnlf_:

• d5xnlf_ first appeared in SCOPe 2.06
  
• d5xnlf_ appears in SCOPe 2.07