![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
![]() | Protein automated matches [339417] (1 species) not a true protein |
![]() | Species Pisum sativum [TaxId:3888] [339418] (1 PDB entry) |
![]() | Domain d5xnlk_: 5xnl k: [339419] Other proteins in same PDB: d5xnla_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlo_ automated match to d2axtk1 complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnlk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnlk_ f.23.36.1 (k:) automated matches {Pisum sativum [TaxId: 3888]} klpeayaflnpivdfmpvipllffllafvwqaavsfr
Timeline for d5xnlk_: