SCOPe 2.06: Domain d5xnlk_: 5xnl k:

Lineage for d5xnlk_ (5xnl k:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.1: PsbK-like [161038] (2 proteins)
   Pfam PF02533

6. Protein automated matches [339417] (1 species)
   not a true protein

7. Species Pisum sativum [TaxId:3888] [339418] (1 PDB entry)

8. Domain d5xnlk_: 5xnl k: [339419]
   Other proteins in same PDB: d5xnla_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlo_
   automated match to d2axtk1
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlk_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (k:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5xnlk_:

Sequence; same for both SEQRES and ATOM records:

>d5xnlk_ f.23.36.1 (k:) automated matches {Pisum sativum [TaxId: 3888]}
klpeayaflnpivdfmpvipllffllafvwqaavsfr

Timeline for d5xnlk_:

• d5xnlk_ is new in SCOPe 2.06-stable
  
• d5xnlk_ appears in SCOPe 2.07
  
• d5xnlk_ appears in the current release, SCOPe 2.08