Lineage for d5xnlk_ (5xnl k:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026682Protein automated matches [339417] (5 species)
    not a true protein
  7. 3026685Species Pea (Pisum sativum) [TaxId:3888] [339418] (1 PDB entry)
  8. 3026686Domain d5xnlk_: 5xnl k: [339419]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
    automated match to d2axtk1
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlk_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (k:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5xnlk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnlk_ f.23.36.1 (k:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
klpeayaflnpivdfmpvipllffllafvwqaavsfr

SCOPe Domain Coordinates for d5xnlk_:

Click to download the PDB-style file with coordinates for d5xnlk_.
(The format of our PDB-style files is described here.)

Timeline for d5xnlk_: