Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (9 species) not a true protein |
Species Pisum sativum [TaxId:3888] [339414] (1 PDB entry) |
Domain d5xnld_: 5xnl d: [339416] Other proteins in same PDB: d5xnlc_, d5xnle_, d5xnlf_, d5xnlk_, d5xnlo_ automated match to d4il6d_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnld_ f.26.1.1 (d:) automated matches {Pisum sativum [TaxId: 3888]} ndlfdimddwlrrdrfvfvgwsglllfpcayfavggwftgttfvtswythglassylegc nfltaavstpanslahsllllwgpeaqgdltrwcqlgglwtfvalhgafgligfmlrqfe larsvqlrpynaiafsgpiavfvsvfliyplgqsgwffapsfgvaaifrfilffqgfhnw tlnpfhmmgvagvlgaallcaihgatventlfedgdgantfrafnptqaeetysmvtanr fwsqifgvafsnkrwlhffmlfvpvtglwmsalgvvglalnlraydfvsqeiraaedpef etfytknillnegirawmatqdqphenlifpeevlprgnal
Timeline for d5xnld_: