Lineage for d5xnld_ (5xnl d:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255521Protein automated matches [190224] (9 species)
    not a true protein
  7. 2255537Species Pisum sativum [TaxId:3888] [339414] (1 PDB entry)
  8. 2255539Domain d5xnld_: 5xnl d: [339416]
    Other proteins in same PDB: d5xnlc_, d5xnle_, d5xnlf_, d5xnlk_, d5xnlo_
    automated match to d4il6d_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnld_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (d:) Photosystem II D2 protein

SCOPe Domain Sequences for d5xnld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnld_ f.26.1.1 (d:) automated matches {Pisum sativum [TaxId: 3888]}
ndlfdimddwlrrdrfvfvgwsglllfpcayfavggwftgttfvtswythglassylegc
nfltaavstpanslahsllllwgpeaqgdltrwcqlgglwtfvalhgafgligfmlrqfe
larsvqlrpynaiafsgpiavfvsvfliyplgqsgwffapsfgvaaifrfilffqgfhnw
tlnpfhmmgvagvlgaallcaihgatventlfedgdgantfrafnptqaeetysmvtanr
fwsqifgvafsnkrwlhffmlfvpvtglwmsalgvvglalnlraydfvsqeiraaedpef
etfytknillnegirawmatqdqphenlifpeevlprgnal

SCOPe Domain Coordinates for d5xnld_:

Click to download the PDB-style file with coordinates for d5xnld_.
(The format of our PDB-style files is described here.)

Timeline for d5xnld_: