SCOPe 2.08: Domain d5xnld_: 5xnl d:

Lineage for d5xnld_ (5xnl d:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [339414] (1 PDB entry)

8. Domain d5xnld_: 5xnl d: [339416]
   Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnlb_, d5xnlc_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
   automated match to d4il6d_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnld_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (d:) Photosystem II D2 protein

SCOPe Domain Sequences for d5xnld_:

Sequence; same for both SEQRES and ATOM records:

>d5xnld_ f.26.1.1 (d:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
ndlfdimddwlrrdrfvfvgwsglllfpcayfavggwftgttfvtswythglassylegc
nfltaavstpanslahsllllwgpeaqgdltrwcqlgglwtfvalhgafgligfmlrqfe
larsvqlrpynaiafsgpiavfvsvfliyplgqsgwffapsfgvaaifrfilffqgfhnw
tlnpfhmmgvagvlgaallcaihgatventlfedgdgantfrafnptqaeetysmvtanr
fwsqifgvafsnkrwlhffmlfvpvtglwmsalgvvglalnlraydfvsqeiraaedpef
etfytknillnegirawmatqdqphenlifpeevlprgnal

Timeline for d5xnld_:

• d5xnld_ first appeared in SCOPe 2.06
  
• d5xnld_ appears in SCOPe 2.07