| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
| Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
| Protein automated matches [191000] (6 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [339410] (1 PDB entry) |
| Domain d5xnle_: 5xnl e: [339411] Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_ automated match to d4pj0e_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnle_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnle_ f.23.38.1 (e:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
rsfadiitsirywiihsitipslfiagwlfvstglaydvfgsprpneyftetrqgiplit
grfdsleqldefsrs
Timeline for d5xnle_: