Lineage for d5xnle_ (5xnl e:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579375Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2579376Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2579404Protein automated matches [191000] (4 species)
    not a true protein
  7. 2579405Species Pea (Pisum sativum) [TaxId:3888] [339410] (1 PDB entry)
  8. 2579406Domain d5xnle_: 5xnl e: [339411]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
    automated match to d4pj0e_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnle_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (e:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5xnle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnle_ f.23.38.1 (e:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
rsfadiitsirywiihsitipslfiagwlfvstglaydvfgsprpneyftetrqgiplit
grfdsleqldefsrs

SCOPe Domain Coordinates for d5xnle_:

Click to download the PDB-style file with coordinates for d5xnle_.
(The format of our PDB-style files is described here.)

Timeline for d5xnle_: