Lineage for d5y91b_ (5y91 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754245Species Ctenopharyngodon idella [TaxId:7959] [189272] (2 PDB entries)
  8. 2754247Domain d5y91b_: 5y91 B: [339402]
    automated match to d3gbla_

Details for d5y91b_

PDB Entry: 5y91 (more details), 1.9 Å

PDB Description: the structure of the mhc class i molecule of bony fishes provides insights into the conserved nature of the antigen-presenting system
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d5y91b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y91b_ b.1.1.0 (B:) automated matches {Ctenopharyngodon idella [TaxId: 7959]}
kvsspkiqvyshypgeygkentlicyvsgfhppdisiellkngeviadaqqtdlafekgw
qfhltksvsfkpeksdeyscsvrhmsktkkivwesnm

SCOPe Domain Coordinates for d5y91b_:

Click to download the PDB-style file with coordinates for d5y91b_.
(The format of our PDB-style files is described here.)

Timeline for d5y91b_: