SCOP 1.73: Domain d1ee9a2: 1ee9 A:3-148

Lineage for d1ee9a2 (1ee9 A:3-148)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein)

6. Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
   the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53239] (2 PDB entries)

8. Domain d1ee9a2: 1ee9 A:3-148 [33936]
   Other proteins in same PDB: d1ee9a1
   complexed with nad

Details for d1ee9a2

PDB Entry: 1ee9, 3 Å

PDB Description: crystal structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae complexed with nad

PDB Compounds: (A:) 5,10-methylenetetrahydrofolate dehydrogenase

SCOP Domain Sequences for d1ee9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ee9a2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kpgrtilaskvaetfnteiinnveeykkthngqgpllvgflanndpaakmyatwtqktse
smgfrydlrviedkdfleeaiiqangddsvngimvyfpvfgnaqdqylqqvvckekdveg
lnhvyyqnlyhnvryldkenrlksil

Timeline for d1ee9a2:

• d1ee9a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ee9a2 appears in SCOP 1.71
  
• d1ee9a2 appears in SCOP 1.75
  
• d1ee9a2 appears in the current release, SCOPe 2.08