Lineage for d1ee9a2 (1ee9 A:3-148)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890462Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
    automatically mapped to Pfam PF00763
  6. 2890463Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. 2890464Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53239] (2 PDB entries)
  8. 2890466Domain d1ee9a2: 1ee9 A:3-148 [33936]
    Other proteins in same PDB: d1ee9a1
    complexed with nad

Details for d1ee9a2

PDB Entry: 1ee9 (more details), 3 Å

PDB Description: crystal structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae complexed with nad
PDB Compounds: (A:) 5,10-methylenetetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d1ee9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee9a2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kpgrtilaskvaetfnteiinnveeykkthngqgpllvgflanndpaakmyatwtqktse
smgfrydlrviedkdfleeaiiqangddsvngimvyfpvfgnaqdqylqqvvckekdveg
lnhvyyqnlyhnvryldkenrlksil

SCOPe Domain Coordinates for d1ee9a2:

Click to download the PDB-style file with coordinates for d1ee9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ee9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee9a1