| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries) |
| Domain d5nw0g_: 5nw0 G: [339359] Other proteins in same PDB: d5nw0b1, d5nw0b2, d5nw0c_, d5nw0e1, d5nw0e2, d5nw0f_, d5nw0h1, d5nw0h2, d5nw0i_, d5nw0k1, d5nw0k2, d5nw0l_ automated match to d1lqba_ complexed with 9bk |
PDB Entry: 5nw0 (more details), 2.3 Å
SCOPe Domain Sequences for d5nw0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nw0g_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d5nw0g_: