SCOPe 2.08: Domain d5ushl1: 5ush L:2-113

Lineage for d5ushl1 (5ush L:2-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ushl1: 5ush L:2-113 [339354]
   Other proteins in same PDB: d5usha_, d5ushe2, d5ushl2, d5ushx1, d5ushx2
   automated match to d4d9ll1

Details for d5ushl1

PDB Entry: 5ush, 2.3 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv66

PDB Compounds: (L:) Fab vv66 light chain

SCOPe Domain Sequences for d5ushl1:

Sequence; same for both SEQRES and ATOM records:

>d5ushl1 b.1.1.0 (L:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliygninrpsgvp
drfsgsksgtsaslaitglqaedeadyycqsydsslsgalfgggtqltvlgq

Timeline for d5ushl1:

• d5ushl1 first appeared in SCOPe 2.06
  
• d5ushl1 appears in SCOPe 2.07