Lineage for d1edza2 (1edz A:3-148)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
    automatically mapped to Pfam PF00763
  6. Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53239] (2 PDB entries)
  8. Domain d1edza2: 1edz A:3-148 [33935]
    Other proteins in same PDB: d1edza1

Details for d1edza2

PDB Entry: 1edz (more details), 2.8 Å

PDB Description: structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae
PDB Compounds: (A:) 5,10-methylenetetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d1edza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kpgrtilaskvaetfnteiinnveeykkthngqgpllvgflanndpaakmyatwtqktse
smgfrydlrviedkdfleeaiiqangddsvngimvyfpvfgnaqdqylqqvvckekdveg
lnhvyyqnlyhnvryldkenrlksil

SCOPe Domain Coordinates for d1edza2 are not available.

Timeline for d1edza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1edza1