Lineage for d5vhga_ (5vhg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971194Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2971195Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2971196Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2971209Protein automated matches [194852] (4 species)
    not a true protein
  7. 2971222Species Human (Homo sapiens) [TaxId:9606] [194887] (2 PDB entries)
  8. 2971223Domain d5vhga_: 5vhg A: [339347]
    automated match to d4aiwa_
    complexed with so4; mutant

Details for d5vhga_

PDB Entry: 5vhg (more details), 1.27 Å

PDB Description: crystal structure of pentad mutant gapr-1
PDB Compounds: (A:) golgi-associated plant pathogenesis-related protein 1

SCOPe Domain Sequences for d5vhga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vhga_ d.111.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saskqfhnevlkahneyrqkhgvpplklckdlnreaqqysealastrilkaspessrgqc
genlawasydqtgkevadrwysaiknynfqqpgftsgtkaftamvwkntkkmgvgkasas
dgssfvvaryfpaggvvnegffeenvlppk

SCOPe Domain Coordinates for d5vhga_:

Click to download the PDB-style file with coordinates for d5vhga_.
(The format of our PDB-style files is described here.)

Timeline for d5vhga_: