SCOPe 2.06: Domain d5usil1: 5usi L:3-108

Lineage for d5usil1 (5usi L:3-108)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
Domain d5usil1: 5usi L:3-108 [339342]
Other proteins in same PDB: d5usib2, d5usil2, d5usix1, d5usix2, d5usiy1, d5usiy2
automated match to d1dn0a1

Details for d5usil1

PDB Entry: 5usi (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138

PDB Compounds: (L:) Fab vv138 Light chain

SCOPe Domain Sequences for d5usil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5usil1 b.1.1.1 (L:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliysassratgipdr
fsgsgsgtdftltisrlepedfavyycqqygssppytfgqgtkvdi

SCOPe Domain Coordinates for d5usil1:

Click to download the PDB-style file with coordinates for d5usil1.
(The format of our PDB-style files is described here.)

Timeline for d5usil1: