Lineage for d1b0aa2 (1b0a A:2-122)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein) Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species) 
Species Escherichia coli [TaxId:562] [53238] (1 PDB entry) 
Domain d1b0aa2: 1b0a A:2-122 [33934]
Other proteins in same PDB: d1b0aa1
Details for d1b0aa2
PDB Entry: 1b0a (more details), 2.56 Å
PDB Description: 5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
SCOP Domain Sequences for d1b0aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli}
aakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkaceev
gfvsrsydlpettseaellelidtlnadntidgilvqlplpagidnvkvlerihpdkdvd
g
SCOP Domain Coordinates for d1b0aa2:
Click to download the PDB-style file with coordinates for d1b0aa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0aa2:
- d1b0aa2 appears in SCOP 1.57
- d1b0aa2 appears in the current release, SCOPe 2.08
View in 3D
