Lineage for d5usll2 (5usl L:109-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034165Domain d5usll2: 5usl L:109-211 [339338]
    Other proteins in same PDB: d5usla_, d5uslx_
    automated match to d4npya2

Details for d5usll2

PDB Entry: 5usl (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv304
PDB Compounds: (L:) Fab vv304 Light chain

SCOPe Domain Sequences for d5usll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5usll2 b.1.1.0 (L:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnsyaassylsltpeqwkshrsyscqvthegstvektmaha

SCOPe Domain Coordinates for d5usll2:

Click to download the PDB-style file with coordinates for d5usll2.
(The format of our PDB-style files is described here.)

Timeline for d5usll2: