SCOPe 2.06: Domain d5usib2: 5usi B:109-215

Lineage for d5usib2 (5usi B:109-215)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5usib2: 5usi B:109-215 [339333]
   Other proteins in same PDB: d5usib1, d5usil1, d5usix1, d5usix2, d5usiy1, d5usiy2
   automated match to d1dn0a2

Details for d5usib2

PDB Entry: 5usi, 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138

PDB Compounds: (B:) Fab vv138 Light chain

SCOPe Domain Sequences for d5usib2:

Sequence; same for both SEQRES and ATOM records:

>d5usib2 b.1.1.2 (B:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5usib2:

• d5usib2 is new in SCOPe 2.06-stable
  
• d5usib2 does not appear in SCOPe 2.07