Lineage for d5ushx1 (5ush X:2-234)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2402282Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2402283Protein automated matches [191011] (14 species)
    not a true protein
  7. 2402421Species Vaccinia virus [TaxId:10245] [256246] (5 PDB entries)
  8. 2402426Domain d5ushx1: 5ush X:2-234 [339330]
    Other proteins in same PDB: d5ushe1, d5ushe2, d5ushl1, d5ushl2, d5ushx2
    automated match to d4etqx_

Details for d5ushx1

PDB Entry: 5ush (more details), 2.3 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv66
PDB Compounds: (X:) IMV membrane protein

SCOPe Domain Sequences for d5ushx1:

Sequence, based on SEQRES records: (download)

>d5ushx1 b.74.1.0 (X:2-234) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyys

Sequence, based on observed residues (ATOM records): (download)

>d5ushx1 b.74.1.0 (X:2-234) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslskphyitenyrnpyklnddtevyys

SCOPe Domain Coordinates for d5ushx1:

Click to download the PDB-style file with coordinates for d5ushx1.
(The format of our PDB-style files is described here.)

Timeline for d5ushx1: