SCOPe 2.08: Domain d5u64b1: 5u64 B:1-113

Lineage for d5u64b1 (5u64 B:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d5u64b1: 5u64 B:1-113 [339321]
   Other proteins in same PDB: d5u64b2
   automated match to d4w81a_

Details for d5u64b1

PDB Entry: 5u64, 1.15 Å

PDB Description: camel nanobody vhh-28

PDB Compounds: (B:) vhh-28

SCOPe Domain Sequences for d5u64b1:

Sequence, based on SEQRES records:

>d5u64b1 b.1.1.1 (B:1-113) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqesgggsvqaggslrlscvasgvtstrpcigwfrqapgkeregvavvnfrgdstyi
tdsvkgrftisrdedsdtvylqmnslkpedtatyycaadvnrggfcyiedwyfsywgqgt
qvtvss

Sequence, based on observed residues (ATOM records):

>d5u64b1 b.1.1.1 (B:1-113) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqesgggsvqaggslrlscvasgvtstrpcigwfrqakeregvavvnfrgdstyitd
svkgrftisrddtvylqmnslkpedtatyycaadvnrggfcyiedwyfsywgqgtqvtvs
s

Timeline for d5u64b1:

• d5u64b1 first appeared in SCOPe 2.06
  
• d5u64b1 appears in SCOPe 2.07