Lineage for d1diba2 (1dib A:2-126)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587802Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 587803Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 587927Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein)
  6. 587928Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. 587934Species Human (Homo sapiens) [TaxId:9606] [53237] (4 PDB entries)
  8. 587941Domain d1diba2: 1dib A:2-126 [33932]
    Other proteins in same PDB: d1diba1, d1dibb1

Details for d1diba2

PDB Entry: 1dib (more details), 2.7 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly345899

SCOP Domain Sequences for d1diba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diba2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens)}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

SCOP Domain Coordinates for d1diba2:

Click to download the PDB-style file with coordinates for d1diba2.
(The format of our PDB-style files is described here.)

Timeline for d1diba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diba1