SCOPe 2.06: Domain d5u65a_: 5u65 A:

Lineage for d5u65a_ (5u65 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)

8. Domain d5u65a_: 5u65 A: [339319]
   automated match to d4w81a_
   complexed with so4

Details for d5u65a_

PDB Entry: 5u65, 2.3 Å

PDB Description: camel nanobody vhh-5

PDB Compounds: (A:) vhh-5

SCOPe Domain Sequences for d5u65a_:

Sequence; same for both SEQRES and ATOM records:

>d5u65a_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqesgggsvqaggslrlscvvsgltisnycmrwfrqapgkgregvasinsagttyya
dsvkgrftmsrdnakntvyldmnslkpedtaiyycasstrvwggycgglddatnndwgqg
tqvtvss

Timeline for d5u65a_:

• d5u65a_ is new in SCOPe 2.06-stable
  
• d5u65a_ appears in SCOPe 2.07
  
• d5u65a_ appears in the current release, SCOPe 2.08